PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_rscf00000137.1.g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 1427aa    MW: 154310 Da    PI: 5.9428
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_rscf00000137.1.g00001.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding31.44.4e-10543585347
                                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
                 Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                     +WT+eE e +++  + +G++ +k+Ia+ +  ++t  +c+++++k+
  FANhyb_rscf00000137.1.g00001.1 543 PWTPEEKEAFIEKLAVFGKD-FKKIASFFD-HKTTADCVEFYYKH 585
                                     8*****************99.*********.************97 PP

2Myb_DNA-binding33.78.2e-11758798345
                                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
                 Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                                      WT eE   +++av  +G++ ++ I+r++  +R+ +qck ++ 
  FANhyb_rscf00000137.1.g00001.1 758 DWTDEEKSSFIQAVSSHGKD-FAMISRCVR-TRSQNQCKVFFS 798
                                     5*****************99.*********.********8876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.42E-14527588IPR009057Homeodomain-like
PROSITE profilePS5129316.148539590IPR017884SANT domain
SMARTSM007172.8E-10540588IPR001005SANT/Myb domain
PfamPF002491.5E-7542585IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.2E-7543587IPR009057Homeodomain-like
PROSITE profilePS5129310.621754805IPR017884SANT domain
SMARTSM007174.0E-8755803IPR001005SANT/Myb domain
SuperFamilySSF466892.5E-10756805IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.7E-7758799IPR009057Homeodomain-like
PfamPF002492.0E-8758798IPR001005SANT/Myb domain
CDDcd001679.10E-7759797No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1427 aa     Download sequence    Send to blast
KGESQPKNVT PLQSPSGDAT ACVTSAAPSE ETTSRKKPRL GWGEGLAKYE KKKVDPADVV  60
MNKDGDVCHV GNVEPVQSVS PHLADKSPRL MVLTDCASPA TPSSVACSSS PGVEEKSFGK  120
AAGVDNDINL YRSPANVSSS LHELLQSDDP SPMDCSTVRH TAMNKLLIWK GDISKVLEVT  180
ESEIDLLENE LKMLNSDSRD TCQCPAASSS LPVEGSDASG KEQATAINLV TRPAPLLVCS  240
SGDTDLEKLA LGNGEQGESC GLKDQDMDSP GTATSKFVDR LPLLNVASSG NSSGCAENQD  300
LVQTVEREAE CLTSGKDEEK SDPSVCGNSG REIVTPVSNG FGICASVVDT LCDSIFSSNK  360
ETASRVSDIF NKLLPKDNCK VNISGLGISS SWKNDSLLKE KFKARKQHLR FMERVITLKY  420
KAHQQLWKED VRLLSERKYR PKSHKKYDLG LRNSSNGYQK HRSSIRSRFS TPAGNLSLVP  480
TKEVEKFANK VLCDSQVKLY RNSLKMPALI LDKKEKIVTR FVSSNGLIED PCAVEKERTL  540
INPWTPEEKE AFIEKLAVFG KDFKKIASFF DHKTTADCVE FYYKHHKSAA FQKTKKKPDT  600
SKLGKSAANT YMINPGTKWN REVNAASLDI LGAASVMAAQ ADGSTRNRTG RLILGGYKNM  660
KTSQGDDATV ERSCSFDVIG DERETAAADV LAGICGSLSS EAVSSCITSS IDPGDGCWEW  720
KCQKVDSQAR RPLTPDVLQT VDDETCSDDS CGEMDPTDWT DEEKSSFIQA VSSHGKDFAM  780
ISRCVRTRSQ NQCKVFFSKA RKCLGLDLVH PRRGNEGASI VDDANGGESD TEDACVVEAG  840
SGISSDKSGC DTNEDLPLSV MDMDHEKTMN LQCDPLGSVE NNVKGEVDLL DKKALRSSDA  900
LEMEDRPKLV FDDLTNIMDV ADRLSESVPA QRSEAFSADV DAVIDNVAEK GSLVAESVVG  960
EGMSSDVPKL EGQDERCNTD TSGCGLQVSV HDSNSSGSAS DMAAEGSCSG LAAECLQQVS  1020
VEFNSMQKSL VNSLLHENLL ATAISENSAV VEYGKAINQD RLSSTSAKQE DRDKQSSSIR  1080
GDDVHKHLPG LPVLRNVDPA HVLKGYPLHM AMGKEINGHT SCGNLSEVKH LSKPDGDLTG  1140
HKPKDCILQF GNCKPRSSQV DFPLVHQKIE RRSDTTKAHS WSSSDTDKPS RNGDVKLFGK  1200
ILTSTSKSGS SIHENEEKGS HTHNLSNKSS NLKFSGHHNL DGNSGVLKFD SSNYAGIENV  1260
PRRNYSFWEG NKVQNGHPSF PDSALLLAKY PAAFGNFPTS SSKLEQQPLA VVRNDGHVNG  1320
ASVFPSREIS SSSSSSVDVK QRQETFDVSR RNGFESVSSL QQQGRGIVGM NGVNVVGRGG  1380
IMVGGPCTGV SDPVAAIRMH YAKTEQYGAQ GIIREEESWR GKGDIGR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_C1e-14506592994NUCLEAR RECEPTOR COREPRESSOR 2
4a69_D1e-14506592994NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004307402.10.0PREDICTED: uncharacterized protein LOC101302495
TrEMBLM5XR660.0M5XR66_PRUPE; Uncharacterized protein
STRINGVIT_13s0019g04010.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF49863352
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.11e-173MYB family protein